PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g039114m
Common NameCISIN_1g039114mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 633aa    MW: 71887.8 Da    PI: 6.6114
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g039114mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS357.52e-1092556252374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+a +s+d++ a +l +++++++spdgd +qRla+yf+++L+arl+++ +  ++    s+ts   ++++l+a+ ++  +sP+ k 
  orange1.1g039114m 255 SSLLTQCAQAAASNDQRVAIELSKQIRQHSSPDGDGTQRLAHYFANGLEARLSGTRTPYFSPAFISKTS---VADVLKAYIVYISASPFRKA 343
                        689***************************************************777777666666666...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s++++N++I + +e++++vHiiDf+is+G+QWp+++q  + Rp+gpp++RiTg++ pe+g   +e++eetg+rL+k Ae+++vpfe+++ +a
  orange1.1g039114m 344 SNFLTNRMIGKTTEKATKVHIIDFGISYGFQWPCFIQRQSFRPGGPPKIRITGIELPEPGfrPAERVEETGHRLKKAAERCNVPFEYSA-IA 434
                        ***********************************************************9*****************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++e+++l++L+++++E+++V ++++l +l+d+++  +s rd+vL+l+k+++P+++v+   +  +ns+ F+ rf ea+ ++salfd+lea++
  orange1.1g039114m 435 QKWETIKLDDLKIDRDEVTVVTCMYRLNYLPDDTQVKDSLRDAVLRLIKRINPDLFVHGVANGTYNSPFFVSRFKEAMFHFSALFDMLEATV 526
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        p+e++ r  +Ere++gr+++nv+aceg er+ + et+++W++r  +aGF+++p++++    +k ++++ + + + v+e+ +++++gWk++ L
  orange1.1g039114m 527 PTEDQGRLIYEREVFGRHAMNVLACEGLERIDNPETYRQWQSRNLRAGFRQLPVDQELLRRVKKMVKMDYHKDFDVDENGQWMLQGWKGKIL 618
                        **********************************************************************888******************* PP

               GRAS 368 vsvSaWr 374
                        +++S+W+
  orange1.1g039114m 619 YALSFWK 625
                        ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.241228605IPR005202Transcription factor GRAS
PfamPF035147.0E-107255625IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MNGFEFGRGS IRACSNHESD HSAMNEFMDH PTDHHLSINS APSLASSSDG ASRYNFENVN  60
FSYAVFKYIN DILMEEDVAS NTCMLQDCLA LQATEKSFYD VLGQQYPPSP NQYSHCFNPN  120
GNSPDDDIDS SSSIDNNNSC DATNNASDEE VRHYSLKGSR GRKIHQIDDR DFLDEGRSNK  180
QLVPLLEEAV RCDMFVEVMI PKGGSYDSVQ CPLFEAARNR AARNLPCDKT KIKGSNSRIL  240
RMMRQDNTSE VVDLSSLLTQ CAQAAASNDQ RVAIELSKQI RQHSSPDGDG TQRLAHYFAN  300
GLEARLSGTR TPYFSPAFIS KTSVADVLKA YIVYISASPF RKASNFLTNR MIGKTTEKAT  360
KVHIIDFGIS YGFQWPCFIQ RQSFRPGGPP KIRITGIELP EPGFRPAERV EETGHRLKKA  420
AERCNVPFEY SAIAQKWETI KLDDLKIDRD EVTVVTCMYR LNYLPDDTQV KDSLRDAVLR  480
LIKRINPDLF VHGVANGTYN SPFFVSRFKE AMFHFSALFD MLEATVPTED QGRLIYEREV  540
FGRHAMNVLA CEGLERIDNP ETYRQWQSRN LRAGFRQLPV DQELLRRVKK MVKMDYHKDF  600
DVDENGQWML QGWKGKILYA LSFWKPVQDS QN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-412546255375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488667.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A067G3750.0A0A067G375_CITSI; Uncharacterized protein
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-166SCARECROW-like 14